OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SGTB (NM_019072) Human Mass Spec Standard

Be the first to review this product
SKU
PH302467
SGTB MS Standard C13 and N15-labeled recombinant protein (NP_061945)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358966 SGTB Antibody - N-terminal region
100 ul
$585.00
LY412784 Transient overexpression lysate of small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta (SGTB) (as WB positive control) 100 ug
$436.00

Other products for "SGTB or NM_019072"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202467
Predicted MW 33.4 kDa
Protein Sequence
Protein Sequence
>RC202467 protein sequence
Red=Cloning site Green=Tags(s)

MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKND
VLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIK
DCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTG
LSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQN
PELIEQLRNHIRSRSFSSSAEEHS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061945
RefSeq Size 5453
RefSeq ORF 912
Synonyms SGT2
Locus ID 54557
UniProt ID Q96EQ0
Cytogenetics 5q12.3
Summary Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SGTB" proteins (3)
SKU Description Size Price
LC412784 Lyophilized SGTB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412784 Transient overexpression lysate of small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta (SGTB) (as WB positive control) 100 ug
$436.00
TP302467 Recombinant protein of human small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta (SGTB), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products