SGTB (NM_019072) Human Recombinant Protein

SKU
TP302467
Recombinant protein of human small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta (SGTB), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202467 protein sequence
Red=Cloning site Green=Tags(s)

MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKND
VLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIK
DCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTG
LSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQN
PELIEQLRNHIRSRSFSSSAEEHS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_061945
Locus ID 54557
UniProt ID Q96EQ0
Cytogenetics 5q12.3
RefSeq Size 5453
RefSeq ORF 912
Synonyms SGT2
Summary Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SGTB (NM_019072) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302467 SGTB MS Standard C13 and N15-labeled recombinant protein (NP_061945) 10 ug
$3,255.00
LC412784 SGTB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412784 Transient overexpression lysate of small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta (SGTB) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.