OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CITED1 (NM_004143) Human Mass Spec Standard

Be the first to review this product
SKU
PH302419
CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_004134)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807075 CITED1 mouse monoclonal antibody, clone OTI3C12 (formerly 3C12) 100 ul
$447.00
LY418187 Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CITED1 or NM_004143"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202419
Predicted MW 19.9 kDa
Protein Sequence
Protein Sequence
>RC202419 protein sequence
Red=Cloning site Green=Tags(s)

MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG
SPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA
GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004134
RefSeq Size 1251
RefSeq ORF 579
Synonyms MSG1
Locus ID 4435
UniProt ID Q99966
Cytogenetics Xq13.1
Summary This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. provided by RefSeq, Jan 2009
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CITED1" proteins (11)
SKU Description Size Price
PH327378 CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138358) 10 ug
$3,360.00
PH327383 CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138359) 10 ug
$3,360.00
LC418187 Lyophilized CITED1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428546 Lyophilized CITED1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428547 Lyophilized CITED1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418187 Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428546 Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428547 Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP302419 Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1, 20 µg 20 ug
$867.00
TP327378 Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3, 20 µg 20 ug
$867.00
TP327383 Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products