CITED1 (NM_001144887) Human Mass Spec Standard

SKU
PH327383
CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138359)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227383]
Predicted MW 19.9 kDa
Protein Sequence
Protein Sequence
>RC227383 protein sequence
Red=Cloning site Green=Tags(s)

MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG
SPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA
GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138359
RefSeq Size 830
RefSeq ORF 579
Synonyms MSG1
Locus ID 4435
UniProt ID Q99966
Cytogenetics Xq13.1
Summary This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:CITED1 (NM_001144887) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302419 CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_004134) 10 ug
$3,255.00
PH327378 CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_001138358) 10 ug
$3,255.00
LC418187 CITED1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428546 CITED1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428547 CITED1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418187 Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1 100 ug
$436.00
LY428546 Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3 100 ug
$436.00
LY428547 Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4 100 ug
$436.00
TP302419 Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 1, 20 µg 20 ug
$867.00
TP327378 Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 3, 20 µg 20 ug
$867.00
TP327383 Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 (CITED1), transcript variant 4, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.