ARMC8 (NM_014154) Human Mass Spec Standard

CAT#: PH302341

ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_054873)

Product Images

Coomassie blue staining of purified ARMC8 protein (Cat# TP302341). The protein was produced from HEK293T cells transfected with ARMC8 cDNA clone (Cat# RC202341) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202341
• Predicted MW: 43 kDa
• Protein Sequence:
  Sequence Link

  >RC202341 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA
  VVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLM
  ALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSM
  TLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLL
  EERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL
  YASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054873
• RefSeq Size: 3236
• RefSeq ORF: 1155
• Synonyms: GID5; HSPC056; S863-2; VID28
• Locus ID: 25852
• UniProt ID: Q8IUR7
• Cytogenetics: 3q22.3
• Summary: Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.[UniProtKB/Swiss-Prot Function]