OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB7B (NM_177403) Human Mass Spec Standard

Be the first to review this product
SKU
PH302283
RAB7B MS Standard C13 and N15-labeled recombinant protein (NP_796377)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY406153 Transient overexpression lysate of RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RAB7B or NM_177403"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202283
Predicted MW 22.5 kDa
Protein Sequence
Protein Sequence
>RC202283 protein sequence
Red=Cloning site Green=Tags(s)

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERF
RSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQG
WCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_796377
RefSeq Size 3032
RefSeq ORF 597
Synonyms RAB7
Locus ID 338382
UniProt ID Q96AH8
Cytogenetics 1q32.1
Summary Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB7B" proteins (6)
SKU Description Size Price
LC406153 Lyophilized RAB7B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431783 Lyophilized RAB7B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406153 Transient overexpression lysate of RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431783 Transient overexpression lysate of RAB7B, member RAS oncogene family (RAB7B), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302283 Recombinant protein of human RAB7B, member RAS oncogene family (RAB7B), 20 µg 20 ug
$867.00
TP328755 Recombinant protein of human RAB7B, member RAS oncogene family (RAB7B), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products