OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB7B (NM_177403) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202283
RAB7B (Myc-DDK-tagged)-Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA385111 Rab7B Rabbit monoclonal Antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RAB7B or NM_177403"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB7B
Synonyms RAB7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202283 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCCCCGGAAGAAGGTGGACCTGAAACTCATTATCGTCGGAGCCATTGGTGTGGGAAAGACCTCCC
TCCTTCACCAATATGTGCACAAGACGTTTTATGAGGAATACCAGACCACACTGGGGGCCAGCATCCTCTC
CAAGATTATCATATTGGGTGACACAACTTTGAAGTTACAGATCTGGGACACGGGCGGTCAGGAGCGGTTC
CGCTCCATGGTGTCCACGTTCTACAAGGGCTCCGATGGCTGCATCCTAGCTTTTGATGTCACCGACCTGG
AGTCTTTTGAAGCCCTGGATATCTGGCGGGGTGATGTCCTGGCCAAGATTGTCCCCATGGAGCAGTCCTA
CCCCATGGTGTTGTTGGGGAACAAGATCGATCTGGCAGACCGGAAGGTACCCCAGGAAGTAGCTCAAGGC
TGGTGTAGAGAGAAAGATATTCCTTACTTTGAAGTCAGTGCCAAGAATGACATCAATGTGGTGCAAGCGT
TTGAGATGCTGGCCAGTAGGGCTCTGTCGAGGTACCAGAGCATCTTAGAAAATCACCTCACAGAATCCAT
CAAGCTCTCGCCAGACCAGTCAAGGAGCAGATGCTGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202283 protein sequence
Red=Cloning site Green=Tags(s)

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERF
RSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQG
WCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_177403
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177403.5
RefSeq Size 3032 bp
RefSeq ORF 600 bp
Locus ID 338382
UniProt ID Q96AH8
Cytogenetics 1q32.1
Protein Families Druggable Genome
MW 22.5 kDa
Summary Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_177403" in other vectors (7)
SKU Description Size Price
RC202283L1 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202283L2 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202283L3 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202283L4 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202283 RAB7B (tGFP-tagged) - Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 10 ug
$489.00 $500.00
SC106979 RAB7B (untagged)-Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 10 ug
$300.00
SC323745 RAB7B (untagged)-Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 10 ug
$300.00

Plasmid Map for RC202283

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202283
Circular map for RC202283

file-alt Citations

ATF3 induces RAB7 to govern autodegradation in paligenosis, a conserved cell plasticity program
Radyk, Spatz, Peña et al
EMBO Rep (2021)
Cited by 41
AI Summary: OriGene’s RAB7B cDNA clone (Catalog #RC202283) was used as a template to generate mutant constructs for functional studies of RAB7B in the investigation of ATF3-mediated autodegradation during paligenosis.
Snippet: RAB7B template was purchased from OriGene (Catalog #RC202283), and the mutant was generated by amplifying a truncated C-terminal domain and a three-part ligation using oligos encoding the mutant N-terminal domain
Negative regulation of EGFR signalling by the human folliculin tumour suppressor protein
Laviolette, Mermoud, Calvo et al
Nat Commun (2017) 8, 15866 DOI: 10.1038/ncomms15866
AI Summary: OriGene products Rab7B-Myc-DDK (RC202283) and Rab35-Myc-DDK (RC201932) were used as expression constructs to study the interaction and functional specificity of Rab GTPases in the regulation of EGFR signalling by the FLCN tumour suppressor protein.
Snippet: Rab7B-Myc-DDK (RC202283) and Rab35-Myc-DDK (RC201932) in pCMV6-Entry were purchased from OriGene Technologies, Inc. (Rockville, MD). HA-Rab7A in pcDNA3 was produced by PCR using HA-eGFP-Rab7A WT as template and with 5′-GCGCGGATCCATGACCTCTAGGAAG-3′ and 5′-GCGCGAATTCAGCAACTGCAGCTTTCTG-3′ oligonucleotides
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products