RAB7B (NM_177403) Human Tagged ORF Clone

SKU
RC202283
RAB7B (Myc-DDK-tagged)-Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB7B
Synonyms RAB7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202283 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCCCCGGAAGAAGGTGGACCTGAAACTCATTATCGTCGGAGCCATTGGTGTGGGAAAGACCTCCC
TCCTTCACCAATATGTGCACAAGACGTTTTATGAGGAATACCAGACCACACTGGGGGCCAGCATCCTCTC
CAAGATTATCATATTGGGTGACACAACTTTGAAGTTACAGATCTGGGACACGGGCGGTCAGGAGCGGTTC
CGCTCCATGGTGTCCACGTTCTACAAGGGCTCCGATGGCTGCATCCTAGCTTTTGATGTCACCGACCTGG
AGTCTTTTGAAGCCCTGGATATCTGGCGGGGTGATGTCCTGGCCAAGATTGTCCCCATGGAGCAGTCCTA
CCCCATGGTGTTGTTGGGGAACAAGATCGATCTGGCAGACCGGAAGGTACCCCAGGAAGTAGCTCAAGGC
TGGTGTAGAGAGAAAGATATTCCTTACTTTGAAGTCAGTGCCAAGAATGACATCAATGTGGTGCAAGCGT
TTGAGATGCTGGCCAGTAGGGCTCTGTCGAGGTACCAGAGCATCTTAGAAAATCACCTCACAGAATCCAT
CAAGCTCTCGCCAGACCAGTCAAGGAGCAGATGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202283 protein sequence
Red=Cloning site Green=Tags(s)

MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERF
RSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQG
WCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_177403
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177403.5
RefSeq Size 3032 bp
RefSeq ORF 600 bp
Locus ID 338382
UniProt ID Q96AH8
Cytogenetics 1q32.1
Protein Families Druggable Genome
MW 22.5 kDa
Summary Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RAB7B (NM_177403) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202283L1 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202283L2 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, mGFP tagged 10 ug
$600.00
RC202283L3 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC202283L4 Lenti ORF clone of Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1, mGFP tagged 10 ug
$600.00
RG202283 RAB7B (tGFP-tagged) - Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC106979 RAB7B (untagged)-Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 10 ug
$300.00
SC323745 RAB7B (untagged)-Human RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.