OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDK3 (NM_005391) Human Mass Spec Standard

Be the first to review this product
SKU
PH302207
PDK3 MS Standard C13 and N15-labeled recombinant protein (NP_005382)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA302064 PDK3 Antibody (N-term)
400 ul
$645.00
LY401655 Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "PDK3 or NM_005391"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202207
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC202207 protein sequence
Red=Cloning site Green=Tags(s)

MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDN
LLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFD
PFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQ
YYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKED
LSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGV
GTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005382
RefSeq Size 1803
RefSeq ORF 1218
Synonyms CMTX6; GS1-358P8.4
Locus ID 5165
UniProt ID Q15120
Cytogenetics Xp22.11
Summary The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle, and thus is one of the major enzymes responsible for the regulation of glucose metabolism. The enzymatic activity of PDH is regulated by a phosphorylation/dephosphorylation cycle, and phosphorylation results in inactivation of PDH. The protein encoded by this gene is one of the three pyruvate dehydrogenase kinases that inhibits the PDH complex by phosphorylation of the E1 alpha subunit. This gene is predominantly expressed in the heart and skeletal muscles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Mar 2010
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDK3" proteins (5)
SKU Description Size Price
LC401655 Lyophilized PDK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428060 Lyophilized PDK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401655 Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428060 Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302207 Recombinant protein of human pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products