PDK3 (NM_005391) Human Recombinant Protein

SKU
TP302207
Recombinant protein of human pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202207 protein sequence
Red=Cloning site Green=Tags(s)

MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDN
LLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFD
PFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQ
YYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKED
LSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGV
GTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 46.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005382
Locus ID 5165
UniProt ID Q15120
Cytogenetics Xp22.11
RefSeq Size 1803
RefSeq ORF 1218
Synonyms CMTX6; GS1-358P8.4
Summary The pyruvate dehydrogenase (PDH) complex is a nuclear-encoded mitochondrial multienzyme complex that catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle, and thus is one of the major enzymes responsible for the regulation of glucose metabolism. The enzymatic activity of PDH is regulated by a phosphorylation/dephosphorylation cycle, and phosphorylation results in inactivation of PDH. The protein encoded by this gene is one of the three pyruvate dehydrogenase kinases that inhibits the PDH complex by phosphorylation of the E1 alpha subunit. This gene is predominantly expressed in the heart and skeletal muscles. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:PDK3 (NM_005391) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302207 PDK3 MS Standard C13 and N15-labeled recombinant protein (NP_005382) 10 ug
$3,255.00
LC401655 PDK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428060 PDK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401655 Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 2 100 ug
$436.00
LY428060 Transient overexpression lysate of pyruvate dehydrogenase kinase, isozyme 3 (PDK3), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.