OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNPDA2 (NM_138335) Human Mass Spec Standard

Be the first to review this product
SKU
PH302194
GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306736 Rabbit Polyclonal GNPDA2 Antibody
100 ug
$640.00
LY403353 Transient overexpression lysate of glucosamine-6-phosphate deaminase 2 (GNPDA2) (as WB positive control) 100 ug
$436.00

Other products for "GNPDA2 or NM_138335"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202194
Predicted MW 30.9 kDa
Protein Sequence
Protein Sequence
>RC202194 protein sequence
Red=Cloning site Green=Tags(s)

MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN
MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP
DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAF
ALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612208
RefSeq Size 2313
RefSeq ORF 825
Synonyms GNP2; SB52
Locus ID 132789
UniProt ID Q8TDQ7
Cytogenetics 4p12
Summary The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. provided by RefSeq, Aug 2012
Protein Pathways Amino sugar and nucleotide sugar metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNPDA2" proteins (3)
SKU Description Size Price
LC403353 Lyophilized GNPDA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403353 Transient overexpression lysate of glucosamine-6-phosphate deaminase 2 (GNPDA2) (as WB positive control) 100 ug
$436.00
TP302194 Recombinant protein of human glucosamine-6-phosphate deaminase 2 (GNPDA2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products