GNPDA2 (NM_138335) Human Tagged ORF Clone

SKU
RC202194
GNPDA2 (Myc-DDK-tagged)-Human glucosamine-6-phosphate deaminase 2 (GNPDA2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GNPDA2
Synonyms GNP2; SB52
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202194 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCTTGTAATTCTTGATAACTATGACTTGGCTAGTGAATGGGCAGCCAAATACATCTGTAATCGCA
TCATTCAGTTCAAACCTGGACAGGACAGATATTTTACACTGGGTTTACCAACAGGGAGTACACCTTTAGG
ATGCTATAAAAAACTAATAGAATATCATAAGAATGGACACCTTTCTTTTAAATATGTGAAGACCTTTAAT
ATGGATGAATATGTAGGACTTCCAAGAAATCATCCTGAAAGCTACCATTCTTATATGTGGAATAATTTTT
TTAAGCATATCGATATAGATCCTAATAATGCACATATCCTTGACGGGAATGCTGCAGATTTACAAGCAGA
ATGTGATGCTTTTGAAAACAAAATAAAAGAAGCTGGAGGAATAGATCTTTTTGTTGGAGGAATTGGTCCA
GATGGTCATATCGCTTTCAATGAGCCTGGATCCAGTTTAGTGTCAAGGACAAGATTAAAGACTCTAGCAA
TGGATACCATCTTGGCAAATGCCAAATATTTTGATGGAGATTTATCAAAAGTGTCAACTATGGCTCTAAC
TGTTGGTGTGGGGACAGTGATGGATGCTAGAGAAGTAATGATCCTTATAACAGGGGCACACAAGGCATTT
GCCCTGTACAAAGCAATAGAAGGAGTCAATCACATGTGGACTGTTTCCGCTTTCCAGCAGCATCCCCGGA
CTATTTTTGTATGCGATGAAGATGCTACTTTAGAATTAAGAGTTAAAACTGTGAAATACTTTAAAGGTCT
AATGCATGTGCACAATAAACTTGTGGATCCACTATTCAGTATGAAAGATGGAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202194 protein sequence
Red=Cloning site Green=Tags(s)

MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN
MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP
DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAF
ALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138335
ORF Size 825 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138335.3
RefSeq Size 2313 bp
RefSeq ORF 831 bp
Locus ID 132789
UniProt ID Q8TDQ7
Cytogenetics 4p12
Domains Glucosamine_iso
Protein Pathways Amino sugar and nucleotide sugar metabolism, Metabolic pathways
MW 30.9 kDa
Summary The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:GNPDA2 (NM_138335) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202194L1 Lenti ORF clone of Human glucosamine-6-phosphate deaminase 2 (GNPDA2), Myc-DDK-tagged 10 ug
$450.00
RC202194L2 Lenti ORF clone of Human glucosamine-6-phosphate deaminase 2 (GNPDA2), mGFP tagged 10 ug
$450.00
RC202194L3 Lenti ORF clone of Human glucosamine-6-phosphate deaminase 2 (GNPDA2), Myc-DDK-tagged 10 ug
$450.00
RC202194L4 Lenti ORF clone of Human glucosamine-6-phosphate deaminase 2 (GNPDA2), mGFP tagged 10 ug
$450.00
RG202194 GNPDA2 (tGFP-tagged) - Human glucosamine-6-phosphate deaminase 2 (GNPDA2) 10 ug
$489.00
SC128186 GNPDA2 (untagged)-Human glucosamine-6-phosphate deaminase 2 (GNPDA2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.