OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KEAP1 (NM_203500) Human Mass Spec Standard

Be the first to review this product
SKU
PH302189
KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_987096)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502059 KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4) 100 ul
$447.00
LY404250 Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "KEAP1 or NM_203500"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202189
Predicted MW 69.7 kDa
Protein Sequence
Protein Sequence
>RC202189 protein sequence
Red=Cloning site Green=Tags(s)

MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL
RLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFA
YTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMH
FGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNF
LQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDG
TWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY
YPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGIT
VHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_987096
RefSeq Size 2606
RefSeq ORF 1872
Synonyms INrf2; KLHL19
Locus ID 9817
UniProt ID Q14145
Cytogenetics 19p13.2
Summary This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KEAP1" proteins (7)
SKU Description Size Price
PH302513 KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036421) 10 ug
$3,360.00
LC402183 Lyophilized KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404250 Lyophilized KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402183 Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404250 Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302189 Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1, 20 µg 20 ug
$867.00
TP302513 Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products