OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEC11C (NM_033280) Human Mass Spec Standard

Be the first to review this product
SKU
PH302122
SEC11C MS Standard C13 and N15-labeled recombinant protein (NP_150596)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403241 Transient overexpression lysate of SEC11 homolog C (S. cerevisiae) (SEC11C) (as WB positive control) 100 ug
$436.00

Other products for "SEC11C or NM_033280"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202122
Predicted MW 21.5 kDa
Protein Sequence
Protein Sequence
>RC202122 protein sequence
Red=Cloning site Green=Tags(s)

MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME
PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE
GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150596
RefSeq Size 793
RefSeq ORF 576
Synonyms SEC11L3; SPC21; SPCS4C
Locus ID 90701
UniProt ID Q9BY50
Cytogenetics 18q21.32
Summary Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.UniProtKB/Swiss-Prot Function
Protein Families Protease, Transmembrane
Protein Pathways Protein export
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEC11C" proteins (3)
SKU Description Size Price
LC403241 Lyophilized SEC11C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403241 Transient overexpression lysate of SEC11 homolog C (S. cerevisiae) (SEC11C) (as WB positive control) 100 ug
$436.00
TP302122 Recombinant protein of human SEC11 homolog C (S. cerevisiae) (SEC11C), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products