OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MSX2 (NM_002449) Human Mass Spec Standard

Be the first to review this product
SKU
PH302056
MSX2 MS Standard C13 and N15-labeled recombinant protein (NP_002440)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329263 Rabbit Polyclonal anti-MSX2 antibody
100 ul
$585.00
LY400874 Transient overexpression lysate of msh homeobox 2 (MSX2) (as WB positive control) 100 ug
$436.00

Other products for "MSX2 or NM_002449"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202056
Predicted MW 28.9 kDa
Protein Sequence
Protein Sequence
>RC202056 protein sequence
Red=Cloning site Green=Tags(s)

MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESA
SAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHTSPTTCTLRKHK
TNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKM
AAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002440
RefSeq Size 2224
RefSeq ORF 801
Synonyms CRS2; FPP; HOX8; MSH; PFM; PFM1
Locus ID 4488
UniProt ID P35548
Cytogenetics 5q35.2
Summary This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MSX2" proteins (3)
SKU Description Size Price
LC400874 Lyophilized MSX2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400874 Transient overexpression lysate of msh homeobox 2 (MSX2) (as WB positive control) 100 ug
$436.00
TP302056 Recombinant protein of human msh homeobox 2 (MSX2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products