MSX2 (NM_002449) Human Tagged ORF Clone

SKU
RC202056
MSX2 (Myc-DDK-tagged)-Human msh homeobox 2 (MSX2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MSX2
Synonyms CRS2; FPP; HOX8; MSH; PFM; PFM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202056 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCTCCGTCCAAAGGCAATGACTTGTTTTCGCCCGACGAGGAGGGCCCAGCAGTGGTGGCCGGAC
CAGGCCCGGGGCCTGGGGGCGCCGAGGGGGCCGCGGAGGAGCGCCGCGTCAAGGTCTCCAGCCTGCCCTT
CAGCGTGGAGGCGCTCATGTCCGACAAGAAGCCGCCCAAGGAGGCGTCCCCGCTGCCGGCCGAAAGCGCC
TCGGCCGGGGCCACCCTGCGGCCACTGCTGCTGTCGGGGCACGGCGCTCGGGAAGCGCACAGCCCCGGGC
CGCTGGTGAAGCCCTTCGAGACCGCCTCGGTCAAGTCGGAAAATTCAGAAGATGGAGCGGCGTGGATGCA
GGAACCCGGCCGATATTCGCCGCCGCCAAGACATACGAGCCCTACCACCTGCACCCTGAGGAAACACAAG
ACCAATCGGAAGCCGCGCACGCCCTTTACCACATCCCAGCTCCTCGCCCTGGAGCGCAAGTTCCGTCAGA
AACAGTACCTCTCCATTGCAGAGCGTGCAGAGTTCTCCAGCTCTCTGAACCTCACAGAGACCCAGGTCAA
AATCTGGTTCCAGAACCGAAGGGCCAAGGCGAAAAGACTGCAGGAGGCAGAACTGGAAAAGCTGAAAATG
GCTGCAAAACCTATGCTGCCCTCCAGCTTCAGTCTCCCTTTCCCCATCAGCTCGCCCCTGCAGGCAGCGT
CCATATATGGAGCATCCTACCCGTTCCATAGACCTGTGCTTCCCATCCCGCCTGTGGGACTCTATGCCAC
GCCAGTGGGATATGGCATGTACCACCTGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202056 protein sequence
Red=Cloning site Green=Tags(s)

MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESA
SAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHTSPTTCTLRKHK
TNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKM
AAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002449
ORF Size 801 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002449.5
RefSeq Size 2224 bp
RefSeq ORF 804 bp
Locus ID 4488
UniProt ID P35548
Cytogenetics 5q35.2
Domains homeobox
Protein Families Druggable Genome, Transcription Factors
MW 28.9 kDa
Summary This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:MSX2 (NM_002449) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202056L1 Lenti ORF clone of Human msh homeobox 2 (MSX2), Myc-DDK-tagged 10 ug
$600.00
RC202056L2 Lenti ORF clone of Human msh homeobox 2 (MSX2), mGFP tagged 10 ug
$600.00
RC202056L3 Lenti ORF clone of Human msh homeobox 2 (MSX2), Myc-DDK-tagged 10 ug
$600.00
RC202056L4 Lenti ORF clone of Human msh homeobox 2 (MSX2), mGFP tagged 10 ug
$600.00
RG202056 MSX2 (tGFP-tagged) - Human msh homeobox 2 (MSX2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118633 MSX2 (untagged)-Human msh homeobox 2 (MSX2) 10 ug
$300.00
SC322436 MSX2 (untagged)-Human msh homeobox 2 (MSX2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.