MSX2 Rabbit Polyclonal Antibody

SKU TA329263

Rabbit Polyclonal anti-MSX2 antibody

Product Data

• Application: IF, WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSX2 antibody: synthetic peptide directed towards the n terminal of human MSX2. Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: msh homeobox 2
• Database Link:
  NP_002440
  P35548
• Background: MSX2 probable play a morphogenetic role. MSX2 may play a role in limb-pattern formation. In osteoblasts, MSX2 suppresses transcription driven by the osteocalcin FGF response element (OCFRE).This gene encodes a member of the muscle segment homeobox gene family. The encoded protein is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. The encoded protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in this gene are associated with parietal foramina 1 and craniosynostosis type 2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CRS2; FPP; HOX8; MSH; PFM; PFM1
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 91%; Mouse: 91%; Rabbit: 91%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors