OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DDT (NM_001355) Human Mass Spec Standard

Be the first to review this product
SKU
PH302047
DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505604 DDT mouse monoclonal antibody, clone OTI1H3 (formerly 1H3) 100 ul
$447.00
LY419969 Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "DDT or NM_001355"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202047
Predicted MW 12.7 kDa
Protein Sequence
Protein Sequence
>RC202047 protein sequence
Red=Cloning site Green=Tags(s)

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT
AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001346
RefSeq Size 688
RefSeq ORF 354
Synonyms D-DT; DDCT; MIF-2; MIF2
Locus ID 1652
UniProt ID P30046
Cytogenetics 22q11.23
Summary D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DDT" proteins (7)
SKU Description Size Price
PH312637 DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861) 10 ug
$3,360.00
LC419969 Lyophilized DDT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421266 Lyophilized DDT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419969 Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421266 Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302047 Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 1, 20 µg 20 ug
$737.00
TP312637 Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products