DDT (NM_001084392) Human Recombinant Protein
SKU
TP312637
Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 2, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC212637 protein sequence
Red=Cloning site Green=Tags(s) MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001077861 |
Locus ID | 1652 |
UniProt ID | P30046 |
Cytogenetics | 22q11.23 |
RefSeq Size | 637 |
RefSeq ORF | 354 |
Synonyms | D-DT; DDCT; MIF-2; MIF2 |
Summary | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302047 | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346) | 10 ug |
$3,255.00
|
|
PH312637 | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861) | 10 ug |
$3,255.00
|
|
LC419969 | DDT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421266 | DDT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425972 | DDT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419969 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 1 | 100 ug |
$436.00
|
|
LY421266 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 2 | 100 ug |
$436.00
|
|
TP302047 | Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.