DDT (NM_001084392) Human Mass Spec Standard

SKU PH312637

DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC212637]
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC212637 protein sequence; Red=Cloning site Green=Tags(s); ; MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT; AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001077861
• RefSeq Size: 637
• RefSeq ORF: 354
• Synonyms: D-DT; DDCT; MIF-2; MIF2
• Locus ID: 1652
• UniProt ID: P30046
• Cytogenetics: 22q11.23
• Summary: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008]