OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD9 (NM_001769) Human Mass Spec Standard

Be the first to review this product
SKU
PH302000
CD9 MS Standard C13 and N15-labeled recombinant protein (NP_001760)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA813476 CD9 mouse monoclonal antibody, clone OTI3D5 100 ul
$447.00
LY400677 Transient overexpression lysate of CD9 molecule (CD9) (as WB positive control) 100 ug
$436.00

Other products for "CD9 or NM_001769"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202000
Predicted MW 25.4 kDa
Protein Sequence
Protein Sequence
>RC202000 protein sequence
Red=Cloning site Green=Tags(s)

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALM
MLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQR
ETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFG
MIFSMILCCAIRRNREMV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001760
RefSeq Size 1321
RefSeq ORF 684
Synonyms BTCC-1; DRAP-27; MIC3; MRP-1; TSPAN-29; TSPAN29
Locus ID 928
UniProt ID P21926
Cytogenetics 12p13.31
Summary This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. provided by RefSeq, Jan 2011
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD9" proteins (3)
SKU Description Size Price
LC400677 Lyophilized CD9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400677 Transient overexpression lysate of CD9 molecule (CD9) (as WB positive control) 100 ug
$436.00
TP302000 Recombinant protein of human CD9 molecule (CD9), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products