OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EMP2 (NM_001424) Human Mass Spec Standard

Be the first to review this product
SKU
PH301995
EMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001415)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351155 Rabbit Polyclonal Anti-EMP2 Antibody
100 ul
$205.00
LY400553 Transient overexpression lysate of epithelial membrane protein 2 (EMP2) (as WB positive control) 100 ug
$436.00

Other products for "EMP2 or NM_001424"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201995
Predicted MW 19.2 kDa
Protein Sequence
Protein Sequence
>RC201995 protein sequence
Red=Cloning site Green=Tags(s)

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL
STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG
YSYILAWVAFACTFISGMMYLILRKRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001415
RefSeq Size 5186
RefSeq ORF 501
Synonyms XMP
Locus ID 2013
UniProt ID P54851
Cytogenetics 16p13.13
Summary This gene encodes a tetraspan protein of the PMP22/EMP family. The encoded protein regulates cell membrane composition. It has been associated with various functions including endocytosis, cell signaling, cell proliferation, cell migration, cell adhesion, cell death, cholesterol homeostasis, urinary albumin excretion, and embryo implantation. It is known to negatively regulate caveolin-1, a scaffolding protein which is the main component of the caveolae plasma membrane invaginations found in most cell types. Through activation of PTK2 it positively regulates vascular endothelial growth factor A. It also modulates the function of specific integrin isomers in the plasma membrane. Up-regulation of this gene has been linked to cancer progression in multiple different tissues. Mutations in this gene have been associated with nephrotic syndrome type 10 (NPHS10). provided by RefSeq, Mar 2015
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EMP2" proteins (3)
SKU Description Size Price
LC400553 Lyophilized EMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400553 Transient overexpression lysate of epithelial membrane protein 2 (EMP2) (as WB positive control) 100 ug
$436.00
TP301995 Recombinant protein of human epithelial membrane protein 2 (EMP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products