EMP2 (NM_001424) Human Tagged ORF Clone

SKU
RC201995
EMP2 (Myc-DDK-tagged)-Human epithelial membrane protein 2 (EMP2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EMP2
Synonyms XMP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201995 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGTGCTTCTTGCTTTCATCATCGCCTTCCACATCACCTCTGCAGCCTTGCTGTTCATTGCCACCG
TCGACAATGCCTGGTGGGTAGGAGATGAGTTTTTTGCAGATGTCTGGAGAATATGTACCAACAACACGAA
TTGCACAGTCATCAATGACAGCTTTCAAGAGTACTCCACGCTGCAGGCGGTCCAGGCCACCATGATCCTC
TCCACCATTCTCTGCTGCATCGCCTTCTTCATCTTCGTGCTCCAGCTCTTCCGCCTGAAGCAGGGAGAGA
GGTTTGTCCTAACCTCCATCATCCAGCTAATGTCATGTCTGTGTGTCATGATTGCGGCCTCCATTTATAC
AGACAGGCGTGAAGACATTCACGACAAAAACGCGAAATTCTATCCCGTGACCAGAGAAGGCAGCTACGGC
TACTCCTACATCCTGGCGTGGGTGGCCTTCGCCTGCACCTTCATCAGCGGCATGATGTACCTGATACTGA
GGAAGCGCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201995 protein sequence
Red=Cloning site Green=Tags(s)

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL
STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG
YSYILAWVAFACTFISGMMYLILRKRK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001424
ORF Size 501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001424.6
RefSeq Size 5186 bp
RefSeq ORF 504 bp
Locus ID 2013
UniProt ID P54851
Cytogenetics 16p13.13
Domains PMP22_Claudin
Protein Families Transmembrane
MW 19.2 kDa
Summary This gene encodes a tetraspan protein of the PMP22/EMP family. The encoded protein regulates cell membrane composition. It has been associated with various functions including endocytosis, cell signaling, cell proliferation, cell migration, cell adhesion, cell death, cholesterol homeostasis, urinary albumin excretion, and embryo implantation. It is known to negatively regulate caveolin-1, a scaffolding protein which is the main component of the caveolae plasma membrane invaginations found in most cell types. Through activation of PTK2 it positively regulates vascular endothelial growth factor A. It also modulates the function of specific integrin isomers in the plasma membrane. Up-regulation of this gene has been linked to cancer progression in multiple different tissues. Mutations in this gene have been associated with nephrotic syndrome type 10 (NPHS10). [provided by RefSeq, Mar 2015]
Write Your Own Review
You're reviewing:EMP2 (NM_001424) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201995L1 Lenti ORF clone of Human epithelial membrane protein 2 (EMP2), Myc-DDK-tagged 10 ug
$600.00
RC201995L2 Lenti ORF clone of Human epithelial membrane protein 2 (EMP2), mGFP tagged 10 ug
$600.00
RC201995L3 Lenti ORF clone of Human epithelial membrane protein 2 (EMP2), Myc-DDK-tagged 10 ug
$600.00
RC201995L4 Lenti ORF clone of Human epithelial membrane protein 2 (EMP2), mGFP tagged 10 ug
$600.00
RG201995 EMP2 (tGFP-tagged) - Human epithelial membrane protein 2 (EMP2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108082 EMP2 (untagged)-Human epithelial membrane protein 2 (EMP2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.