OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ACYP2 (NM_138448) Human Mass Spec Standard

Be the first to review this product
SKU
PH301976
ACYP2 MS Standard C13 and N15-labeled recombinant protein (NP_612457)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408599 Transient overexpression lysate of acylphosphatase 2, muscle type (ACYP2) (as WB positive control) 100 ug
$436.00

Other products for "ACYP2 or NM_138448"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201976
Predicted MW 11.1 kDa
Protein Sequence
Protein Sequence
>RC201976 protein sequence
Red=Cloning site Green=Tags(s)

MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVG
SPSSRIDRTNFSNEKTISKLEYSNFSIRY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612457
RefSeq Size 1238
RefSeq ORF 297
Synonyms ACYM; ACYP
Locus ID 98
UniProt ID P14621
Cytogenetics 2p16.2
Summary Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Feb 2016
Protein Pathways Pyruvate metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ACYP2" proteins (3)
SKU Description Size Price
LC408599 Lyophilized ACYP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408599 Transient overexpression lysate of acylphosphatase 2, muscle type (ACYP2) (as WB positive control) 100 ug
$436.00
TP301976 Recombinant protein of human acylphosphatase 2, muscle type (ACYP2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products