HEBP1 (NM_015987) Human Mass Spec Standard

CAT#: PH301873

HEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_057071)

Product Images

Coomassie blue staining of purified HEBP1 protein (Cat# TP301873). The protein was produced from HEK293T cells transfected with HEBP1 cDNA clone (Cat# RC201873) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201873
• Predicted MW: 21.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201873 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTN
  DKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAK
  EADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057071
• RefSeq Size: 1221
• RefSeq ORF: 567
• Synonyms: HBP; HEBP
• Locus ID: 50865
• UniProt ID: Q9NRV9, A0A024RAS8
• Cytogenetics: 12p13.1
• Summary: The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq, Jul 2008]