OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RNF141 (NM_016422) Human Mass Spec Standard

Be the first to review this product
SKU
PH301861
RNF141 MS Standard C13 and N15-labeled recombinant protein (NP_057506)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365339 RNF141 rabbit polyclonal antibody
100 ul
$310.00
LY414010 Transient overexpression lysate of ring finger protein 141 (RNF141) (as WB positive control) 100 ug
$436.00

Other products for "RNF141 or NM_016422"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201861
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC201861 protein sequence
Red=Cloning site Green=Tags(s)

MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDS
SAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQAS
LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTE
DDMANYILNMADEAGQPHRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057506
RefSeq Size 4084
RefSeq ORF 690
Synonyms RFP141; ZFP26; ZNF230
Locus ID 50862
UniProt ID Q8WVD5
Cytogenetics 11p15
Summary The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RNF141" proteins (3)
SKU Description Size Price
LC414010 Lyophilized RNF141 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414010 Transient overexpression lysate of ring finger protein 141 (RNF141) (as WB positive control) 100 ug
$436.00
TP301861 Recombinant protein of human ring finger protein 141 (RNF141), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products