RNF141 (NM_016422) Human Tagged ORF Clone

SKU
RC201861
RNF141 (Myc-DDK-tagged)-Human ring finger protein 141 (RNF141)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNF141
Synonyms RFP141; ZFP26; ZNF230
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201861 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGACAGCAAATTTCGGATCAGACACAGTTGGTTATTAACAAGTTACCAGAAAAAGTAGCAAAACATG
TTACGTTGGTTCGAGAGAGTGGCTCCTTAACTTATGAAGAATTTCTCGGGAGAGTAGCTGAGCTTAATGA
TGTAACGGCTAAAGTGGCTTCTGGCCAGGAAAAACATCTTCTCTTTGAGGTACAACCTGGGTCTGATTCC
TCTGCTTTTTGGAAAGTGGTTGTACGGGTGGTCTGTACCAAGATTAACAAAAGCAGTGGCATTGTGGAGG
CATCACGGATCATGAATTTATACCAGTTTATTCAACTTTATAAAGATATCACAAGTCAAGCAGCAGGAGT
ATTGGCACAGAGCTCCACCTCTGAAGAACCTGATGAAAACTCATCCTCTGTAACATCTTGTCAGGCTAGT
CTTTGGATGGGAAGGGTGAAGCAGCTGACCGATGAGGAGGAGTGTTGTATCTGTATGGATGGGCGGGCTG
ACCTCATCCTGCCTTGTGCTCACAGCTTTTGTCAGAAGTGTATTGATAAATGGAGTGATCGACACAGGAA
TTGCCCTATTTGTCGCCTACAGATGACTGGAGCAAATGAATCTTGGGTGGTATCAGATGCACCCACTGAA
GATGATATGGCTAACTATATTCTTAACATGGCTGATGAGGCAGGCCAGCCCCACAGGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201861 protein sequence
Red=Cloning site Green=Tags(s)

MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDS
SAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQAS
LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTE
DDMANYILNMADEAGQPHRP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016422
ORF Size 690 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016422.2
RefSeq Size 4084 bp
RefSeq ORF 693 bp
Locus ID 50862
UniProt ID Q8WVD5
Cytogenetics 11p15
Domains RING
Protein Families Druggable Genome, Transcription Factors
MW 25.5 kDa
Summary The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RNF141 (NM_016422) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201861L3 Lenti ORF clone of Human ring finger protein 141 (RNF141), Myc-DDK-tagged 10 ug
$600.00
RC201861L4 Lenti ORF clone of Human ring finger protein 141 (RNF141), mGFP tagged 10 ug
$600.00
RG201861 RNF141 (tGFP-tagged) - Human ring finger protein 141 (RNF141) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108828 RNF141 (untagged)-Human ring finger protein 141 (RNF141) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.