OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF3S2 (EIF3I) (NM_003757) Human Mass Spec Standard

Be the first to review this product
SKU
PH301833
EIF3I MS Standard C13 and N15-labeled recombinant protein (NP_003748)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358798 EIF3I Antibody - C-terminal region
100 ul
$585.00
LY401235 Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit I (EIF3I) (as WB positive control) 100 ug
$436.00

Other products for "EIF3S2 or NM_003757"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201833
Predicted MW 36.5 kDa
Protein Sequence
Protein Sequence
>RC201833 protein sequence
Red=Cloning site Green=Tags(s)

MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTG
SADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYM
KIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN
TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGR
VKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003748
RefSeq Size 1458
RefSeq ORF 975
Synonyms eIF3-beta; eIF3-p36; EIF3S2; PRO2242; TRIP-1; TRIP1
Locus ID 8668
UniProt ID Q13347
Cytogenetics 1p35.2
Summary Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF3S2" proteins (3)
SKU Description Size Price
LC401235 Lyophilized EIF3I HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401235 Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit I (EIF3I) (as WB positive control) 100 ug
$436.00
TP301833 Recombinant protein of human eukaryotic translation initiation factor 3, subunit I (EIF3I), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products