OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WDR46 (NM_005452) Human Mass Spec Standard

Be the first to review this product
SKU
PH301770
WDR46 MS Standard C13 and N15-labeled recombinant protein (NP_005443)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358303 WDR46 Antibody - C-terminal region
100 ul
$585.00
LY431478 Transient overexpression lysate of WD repeat domain 46 (WDR46), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "WDR46 or NM_005452"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201770
Predicted MW 68 kDa
Protein Sequence
Protein Sequence
>RC201770 protein sequence
Red=Cloning site Green=Tags(s)

METAPKPGKDVPPKKDKLQTKRKKPRRYWEEETVPTTAGASPGPPRNKKNRELRPQRPKNAYILKKSRIS
KKPQVPKKPREWKNPESQRGLSGAQDPFPGPAPVPVEVVQKFCRIDKSRKLPHSKAKTRSRLEVAEAEEE
ETSIKAARSELLLAEEPGFLEGEDGEDTAKICQADIVEAVDIASAAKHFDLNLRQFGPYRLNYSRTGRHL
AFGGRRGHVAALDWVTKKLMCEINVMEAVRDIRFLHSEALLAVAQNRWLHIYDNQGIELHCIRRCDRVTR
LEFLPFHFLLATASETGFLTYLDVSVGKIVAALNARAGRLDVMSQNPYNAVIHLGHSNGTVSLWSPAMKE
PLAKILCHRGGVRAVAVDSTGTYMATSGLDHQLKIFDLRGTYQPLSTRTLPHGAGHLAFSQRGLLVAGMG
DVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLVPGAGEPNFDGLESNP
YRSRKQRQEWEVKALLEKVPAELICLDPRALAEVDVISLEQGKKEQIERLGYDPQAKAPFQPKPKQKGRS
STASLVKRKRKVMDEEHRDKVRQSLQQQHHKEAKAKPTGARPSALDRFVR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005443
RefSeq Size 2363
RefSeq ORF 1830
Synonyms BING4; C6orf11; FP221; UTP7
Locus ID 9277
UniProt ID O15213
Cytogenetics 6p21.32
Summary Scaffold component of the nucleolar structure. Required for localization of DDX21 and NCL to the granular compartment of the nucleolus.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WDR46" proteins (5)
SKU Description Size Price
LC417292 Lyophilized WDR46 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431478 Lyophilized WDR46 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417292 Transient overexpression lysate of WD repeat domain 46 (WDR46), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431478 Transient overexpression lysate of WD repeat domain 46 (WDR46), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301770 Recombinant protein of human WD repeat domain 46 (WDR46), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products