OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ILF2 (NM_004515) Human Mass Spec Standard

Be the first to review this product
SKU
PH301751
ILF2 MS Standard C13 and N15-labeled recombinant protein (NP_004506)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500674 Anti-ILF2 mouse monoclonal antibody, clone OTI6F1 (formerly 6F1) 100 ul
$447.00
LY401437 Transient overexpression lysate of interleukin enhancer binding factor 2, 45kDa (ILF2) (as WB positive control) 100 ug
$436.00

Other products for "ILF2 or NM_004515"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201751
Predicted MW 43.1 kDa
Protein Sequence
Protein Sequence
>RC201751 protein sequence
Red=Cloning site Green=Tags(s)

MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAE
QASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN
KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARW
FEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF
LPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI
VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004506
RefSeq Size 1934
RefSeq ORF 1170
Synonyms NF45; PRO3063
Locus ID 3608
UniProt ID Q12905
Cytogenetics 1q21.3
Summary The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. provided by RefSeq, Dec 2014
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ILF2" proteins (3)
SKU Description Size Price
LC401437 Lyophilized ILF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401437 Transient overexpression lysate of interleukin enhancer binding factor 2, 45kDa (ILF2) (as WB positive control) 100 ug
$436.00
TP301751 Recombinant protein of human interleukin enhancer binding factor 2, 45kDa (ILF2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products