ILF2 (NM_004515) Human Tagged ORF Clone

SKU
RC201751
ILF2 (Myc-DDK-tagged)-Human interleukin enhancer binding factor 2, 45kDa (ILF2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ILF2
Synonyms NF45; PRO3063
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201751 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGGTGACAGAGGCCGTGGTCGTGGTGGGCGCTTTGGTTCCAGAGGAGGCCCAGGAGGAGGGTTCA
GGCCCTTTGTACCACATATCCCATTTGACTTCTATTTGTGTGAAATGGCCTTTCCCCGGGTCAAGCCAGC
ACCTGATGAAACTTCCTTCAGTGAGGCCTTGCTGAAGAGGAATCAGGACCTGGCTCCCAATTCTGCTGAA
CAGGCATCTATCCTTTCTCTGGTGACAAAAATAAACAATGTGATTGATAATCTGATTGTGGCTCCAGGGA
CATTTGAAGTGCAAATTGAAGAAGTTCGACAGGTGGGATCCTATAAAAAGGGGACAATGACTACAGGACA
CAATGTGGCTGACCTGGTGGTGATACTCAAGATTCTGCCAACGTTGGAAGCTGTTGCTGCCCTGGGGAAC
AAAGTCGTGGAAAGCCTAAGAGCACAGGATCCTTCTGAAGTTTTAACCATGCTGACCAACGAAACTGGCT
TTGAAATCAGTTCTTCTGATGCTACAGTGAAGATTCTCATTACAACAGTGCCACCCAATCTTCGAAAACT
GGATCCAGAACTCCATTTGGATATCAAAGTATTGCAGAGTGCCTTAGCAGCCATCCGACATGCCCGCTGG
TTCGAGGAAAATGCTTCTCAGTCCACAGTTAAAGTTCTCATCAGACTACTGAAGGACTTGAGGATTCGTT
TTCCTGGCTTTGAGCCCCTCACACCCTGGATCCTTGACCTACTAGGCCATTATGCTGTGATGAACAACCC
CACCAGACAGCCTTTGGCCCTAAACGTTGCATACAGGCGCTGCTTGCAGATTCTGGCTGCAGGACTGTTC
CTGCCAGGTTCAGTGGGTATCACTGACCCCTGTGAGAGTGGCAACTTTAGAGTACACACAGTCATGACCC
TAGAACAGCAGGACATGGTCTGCTATACAGCTCAGACTCTCGTCCGAATCCTCTCACATGGTGGCTTTAG
GAAGATCCTTGGCCAGGAGGGTGATGCCAGCTATCTTGCTTCTGAAATATCTACCTGGGATGGAGTGATA
GTAACACCTTCAGAAAAGGCTTATGAGAAGCCACCAGAGAAGAAGGAAGGAGAGGAAGAAGAGGAGAATA
CAGAAGAACCACCTCAAGGAGAGGAAGAAGAAAGCATGGAAACTCAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201751 protein sequence
Red=Cloning site Green=Tags(s)

MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAE
QASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN
KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARW
FEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF
LPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI
VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004515
ORF Size 1170 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004515.4
RefSeq Size 1934 bp
RefSeq ORF 1173 bp
Locus ID 3608
UniProt ID Q12905
Cytogenetics 1q21.3
Domains DZF
Protein Families Druggable Genome, Transcription Factors
MW 43.1 kDa
Summary The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14. [provided by RefSeq, Dec 2014]
Write Your Own Review
You're reviewing:ILF2 (NM_004515) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201751L1 Lenti ORF clone of Human interleukin enhancer binding factor 2, 45kDa (ILF2), Myc-DDK-tagged 10 ug
$986.00
RC201751L2 Lenti ORF clone of Human interleukin enhancer binding factor 2, 45kDa (ILF2), mGFP tagged 10 ug
$986.00
RC201751L3 Lenti ORF clone of Human interleukin enhancer binding factor 2, 45kDa (ILF2), Myc-DDK-tagged 10 ug
$986.00
RC201751L4 Lenti ORF clone of Human interleukin enhancer binding factor 2, 45kDa (ILF2), mGFP tagged 10 ug
$986.00
RG201751 ILF2 (tGFP-tagged) - Human interleukin enhancer binding factor 2, 45kDa (ILF2) 10 ug
$886.00
SC126956 ILF2 (untagged)-Human interleukin enhancer binding factor 2, 45kDa (ILF2) 10 ug
$457.00
SC320598 ILF2 (untagged)-Human interleukin enhancer binding factor 2, 45kDa (ILF2) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.