OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SF2 (SRSF1) (NM_006924) Human Mass Spec Standard

Be the first to review this product
SKU
PH301636
SFRS1 MS Standard C13 and N15-labeled recombinant protein (NP_008855)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA385321 SF2 Rabbit monoclonal Antibody
100 ul
$380.00
LY402060 Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SF2 or NM_006924"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201636
Predicted MW 27.7 kDa
Protein Sequence
Protein Sequence
>RC201636 protein sequence
Red=Cloning site Green=Tags(s)

MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA
VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH
MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008855
RefSeq Size 5468
RefSeq ORF 744
Synonyms ASF; SF2; SF2p33; SFRS1; SRp30a
Locus ID 6426
UniProt ID Q07955
Cytogenetics 17q22
Summary This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. provided by RefSeq, Jun 2014
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SF2" proteins (8)
SKU Description Size Price
LC402060 Lyophilized SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421492 Lyophilized SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425877 Lyophilized SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402060 Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421492 Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY425877 Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301636 Recombinant protein of human splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1, 20 µg 20 ug
$737.00
TP761870 Purified recombinant protein of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products