OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201636
SRSF1 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA385321 SF2 Rabbit monoclonal Antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SF2 or NM_006924"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SF2
Synonyms ASF; SF2; SF2p33; SFRS1; SRp30a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201636 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGAGGTGGTGTGATTCGTGGCCCCGCAGGGAACAACGATTGCCGCATCTACGTGGGTAACTTAC
CTCCAGACATCCGAACCAAGGACATTGAGGACGTGTTCTACAAATACGGCGCTATCCGCGACATCGACCT
CAAGAATCGCCGCGGGGGACCGCCCTTCGCCTTCGTTGAGTTCGAGGACCCGCGAGACGCGGAAGACGCG
GTGTATGGTCGCGACGGCTATGATTACGATGGGTACCGTCTGCGGGTGGAGTTTCCTCGAAGCGGCCGTG
GAACAGGCCGAGGCGGCGGCGGGGGTGGAGGTGGCGGAGCTCCCCGAGGTCGCTATGGCCCCCCATCCAG
GCGGTCTGAAAACAGAGTGGTTGTCTCTGGACTGCCTCCAAGTGGAAGTTGGCAGGATTTAAAGGATCAC
ATGCGTGAAGCAGGTGATGTATGTTATGCTGATGTTTACCGAGATGGCACTGGTGTCGTGGAGTTTGTAC
GGAAAGAAGATATGACCTATGCAGTTCGAAAACTGGATAACACTAAGTTTAGATCTCATGAGGGAGAAAC
TGCCTACATCCGGGTTAAAGTTGATGGGCCCAGAAGTCCAAGTTATGGAAGATCTCGATCTCGAAGCCGT
AGTCGTAGCAGAAGCCGTAGCAGAAGCAACAGCAGGAGTCGCAGTTACTCCCCAAGGAGAAGCAGAGGAT
CACCACGCTATTCTCCCCGTCATAGCAGATCTCGCTCTCGTACA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201636 protein sequence
Red=Cloning site Green=Tags(s)

MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA
VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH
MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006924
ORF Size 744 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006924.5
RefSeq Size 5468 bp
RefSeq ORF 747 bp
Locus ID 6426
UniProt ID Q07955
Cytogenetics 17q22
Domains RRM
Protein Families Stem cell - Pluripotency
Protein Pathways Spliceosome
MW 27.7 kDa
Summary This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. provided by RefSeq, Jun 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006924" in other vectors (7)
SKU Description Size Price
RC201636L1 Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC201636L2 Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, mGFP tagged 10 ug
$750.00
RC201636L3 Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, Myc-DDK-tagged 10 ug
$750.00
RC201636L4 Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, mGFP tagged 10 ug
$750.00
RG201636 SRSF1 (tGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1 10 ug
$489.00 $650.00
SC115786 SRSF1 (untagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1 10 ug
$450.00
SC323930 SRSF1 (untagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1 10 ug
$450.00

Plasmid Map for RC201636

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201636
Circular map for RC201636

file-alt Citations

SRSF1 and PTBP1 Are trans-Acting Factors That Suppress the Formation of a CD33 Splicing Isoform Linked to Alzheimer's Disease Risk
van Bergeijk, Seneviratne, Aparicio-Prat et al
Mol. Cell. Biol. (2019) 39 (18) DOI: 10.1128/MCB.00568-18
AI Summary: OriGene products pCMV6-SRSF2-myc-DDK (RC209842) and pCMV6-SRSF1-myc-DDK (RC201636) were used as expression constructs to study the roles of SRSF2 and SRSF1 in regulating CD33 exon-2 splicing in the context of Alzheimer's disease risk.
Snippet: The following constructs have been described: pCMV6 -SRSF2 -myc -DDK (Origene, # 555 RC209842, NM_003016), pCMV6 -SRSF1 -myc -DDK (Origene, # RC201636, 556 NM_006924), pCDNA3.1/Zeo (+) (ThermoFisher Scientific, # V86020), pCMV -3TAG - 557 1a -PTBP1 (Genscript, clone OHu15891C, NM_002819.4), pCMV -3TAG -1a -MATR3 558 (Genscript, clone OHu17749C, NM_018834.5 ), pCMV -3TAG -1a -SRSF1 -isoform 1 559 (Genscript, clone OHu24158C, NM_006924.4)
Genomic Landscape Survey Identifies SRSF1 as a Key Oncodriver in Small Cell Lung Cancer
Jiang, Huang, Higgs et al
PLoS Genet. (2016) 12 (4), e1005895 DOI: 10.1371/journal.pgen.1005895
Cited by 283
AI Summary: OriGene’s myc/flag-tagged SRSF1 expression vector (NM_006924.4) was used to overexpress SRSF1 in SCLC cell lines, enabling the study of its functional role in tumorigenicity and DNA repair in this research.
Snippet: SCLC cell lines were cotransfected with 800 ng myc/flag-tagged SRSF1 vector (Origene) encoding the open reading frame of either the wildtype gene (NM_006924.4 with 25 nM of either non-targeting siRNA or SRSF1 siRNA-2 using Lipofectamine RNAiMAX (Life Technologies)
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products