OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFITM1 (NM_003641) Human Mass Spec Standard

Be the first to review this product
SKU
PH301617
IFITM1 MS Standard C13 and N15-labeled recombinant protein (NP_003632)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401205 Transient overexpression lysate of interferon induced transmembrane protein 1 (9-27) (IFITM1) (as WB positive control) 100 ug
$436.00

Other products for "IFITM1 or NM_003641"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201617
Predicted MW 13.9 kDa
Protein Sequence
Protein Sequence
>RC201617 protein sequence
Red=Cloning site Green=Tags(s)

MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG
DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003632
RefSeq Size 733
RefSeq ORF 375
Synonyms 9-27; CD225; DSPA2a; IFI17; LEU13
Locus ID 8519
UniProt ID P13164
Cytogenetics 11p15.5
Summary IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Also implicated in cell adhesion and control of cell growth and migration. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activation or by arresting cell growth in G1 phase in a p53-dependent manner. Acts as a positive regulator of osteoblast differentiation.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Protein Pathways B cell receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFITM1" proteins (3)
SKU Description Size Price
LC401205 Lyophilized IFITM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401205 Transient overexpression lysate of interferon induced transmembrane protein 1 (9-27) (IFITM1) (as WB positive control) 100 ug
$436.00
TP301617 Recombinant protein of human interferon induced transmembrane protein 1 (9-27) (IFITM1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products