OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

S100A4 (NM_019554) Human Mass Spec Standard

Be the first to review this product
SKU
PH301616
S100A4 MS Standard C13 and N15-labeled recombinant protein (NP_062427)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418991 Transient overexpression lysate of S100 calcium binding protein A4 (S100A4), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "S100A4 or NM_019554"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201616
Predicted MW 11.7 kDa
Protein Sequence
Protein Sequence
>RC201616 protein sequence
Red=Cloning site Green=Tags(s)

MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV
DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_062427
RefSeq Size 564
RefSeq ORF 303
Synonyms 18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98
Locus ID 6275
UniProt ID P26447
Cytogenetics 1q21.3
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "S100A4" proteins (7)
SKU Description Size Price
PH303035 S100A4 MS Standard C13 and N15-labeled recombinant protein (NP_002952) 10 ug
$3,360.00
LC412695 Lyophilized S100A4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418991 Lyophilized S100A4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412695 Transient overexpression lysate of S100 calcium binding protein A4 (S100A4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418991 Transient overexpression lysate of S100 calcium binding protein A4 (S100A4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301616 Recombinant protein of human S100 calcium binding protein A4 (S100A4), transcript variant 2, 20 µg 20 ug
$737.00
TP303035 Recombinant protein of human S100 calcium binding protein A4 (S100A4), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products