OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SAR1 (SAR1A) (NM_020150) Human Mass Spec Standard

Be the first to review this product
SKU
PH301450
SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_064535)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324879 SAR1A Antibody (Center)
400 ul
$645.00
LY402753 Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SAR1 or NM_020150"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201450
Predicted MW 22.4 kDa
Protein Sequence
Protein Sequence
>RC201450 protein sequence
Red=Cloning site Green=Tags(s)

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064535
RefSeq Size 3018
RefSeq ORF 594
Synonyms masra2; SAR1; Sara; SARA1
Locus ID 56681
UniProt ID Q9NR31
Cytogenetics 10q22.1
Summary Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SAR1" proteins (7)
SKU Description Size Price
PH326577 SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_001136120) 10 ug
$3,360.00
LC402753 Lyophilized SAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428231 Lyophilized SAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402753 Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428231 Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301450 Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2, 20 µg 20 ug
$867.00
TP326577 Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products