SAR1 (SAR1A) (NM_020150) Human Recombinant Protein

SKU
TP301450
Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201450 protein sequence
Red=Cloning site Green=Tags(s)

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064535
Locus ID 56681
UniProt ID Q9NR31
Cytogenetics 10q22.1
RefSeq Size 3018
RefSeq ORF 594
Synonyms masra2; SAR1; Sara; SARA1
Summary Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SAR1 (SAR1A) (NM_020150) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301450 SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_064535) 10 ug
$3,255.00
PH326577 SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_001136120) 10 ug
$3,255.00
LC402753 SAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428231 SAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402753 Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2 100 ug
$436.00
LY428231 Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1 100 ug
$436.00
TP326577 Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.