SAR1 (SAR1A) (NM_001142648) Human Mass Spec Standard

SKU
PH326577
SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_001136120)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226577]
Predicted MW 22.4 kDa
Protein Sequence
Protein Sequence
>RC226577 protein sequence
Red=Cloning site Green=Tags(s)

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001136120
RefSeq Size 3088
RefSeq ORF 594
Synonyms masra2; SAR1; Sara; SARA1
Locus ID 56681
UniProt ID Q9NR31
Cytogenetics 10q22.1
Summary Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SAR1 (SAR1A) (NM_001142648) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301450 SAR1A MS Standard C13 and N15-labeled recombinant protein (NP_064535) 10 ug
$3,255.00
LC402753 SAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428231 SAR1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402753 Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2 100 ug
$436.00
LY428231 Transient overexpression lysate of SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1 100 ug
$436.00
TP301450 Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326577 Recombinant protein of human SAR1 homolog A (S. cerevisiae) (SAR1A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.