OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VPS37B (NM_024667) Human Mass Spec Standard

Be the first to review this product
SKU
PH301432
VPS37B MS Standard C13 and N15-labeled recombinant protein (NP_078943)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA383264 VPS37B Rabbit polyclonal Antibody
100 ul
$410.00
LY411183 Transient overexpression lysate of vacuolar protein sorting 37 homolog B (S. cerevisiae) (VPS37B) (as WB positive control) 100 ug
$436.00

Other products for "VPS37B or NM_024667"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201432
Predicted MW 31.3 kDa
Protein Sequence
Protein Sequence
>RC201432 protein sequence
Red=Cloning site Green=Tags(s)

MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLK
ARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFID
VYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPP
PPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQP
GFILQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078943
RefSeq Size 2766
RefSeq ORF 855
Locus ID 79720
UniProt ID Q9H9H4
Cytogenetics 12q24.31
Summary Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation.UniProtKB/Swiss-Prot Function
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VPS37B" proteins (3)
SKU Description Size Price
LC411183 Lyophilized VPS37B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411183 Transient overexpression lysate of vacuolar protein sorting 37 homolog B (S. cerevisiae) (VPS37B) (as WB positive control) 100 ug
$436.00
TP301432 Recombinant protein of human vacuolar protein sorting 37 homolog B (S. cerevisiae) (VPS37B), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products