OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAP1 (NM_006367) Human Mass Spec Standard

Be the first to review this product
SKU
PH301394
CAP1 MS Standard C13 and N15-labeled recombinant protein (NP_006358)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY401914 Transient overexpression lysate of CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CAP1 or NM_006367"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201394
Predicted MW 51.7 kDa
Protein Sequence
Protein Sequence
>RC201394 protein sequence
Red=Cloning site Green=Tags(s)

MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQ
KHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQA
LGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKT
GPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKT
HKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQV
AYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006358
RefSeq Size 2798
RefSeq ORF 1425
Synonyms CAP; CAP1-PEN
Locus ID 10487
UniProt ID Q01518
Cytogenetics 1p34.2
Summary The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants encoding different isoforms have been identified. provided by RefSeq, Aug 2016
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAP1" proteins (7)
SKU Description Size Price
PH325806 CAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001099000) 10 ug
$3,360.00
LC401914 Lyophilized CAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426252 Lyophilized CAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401914 Transient overexpression lysate of CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426252 Transient overexpression lysate of CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301394 Recombinant protein of human CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 1, 20 µg 20 ug
$867.00
TP325806 Purified recombinant protein of Homo sapiens CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products