CAP1 (NM_001105530) Human Mass Spec Standard

SKU
PH325806
CAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001099000)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225806]
Predicted MW 51.7 kDa
Protein Sequence
Protein Sequence
>RC225806 protein sequence
Red=Cloning site Green=Tags(s)

MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQ
KHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQA
LGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKT
GPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKT
HKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQV
AYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001099000
RefSeq Size 2780
RefSeq ORF 1425
Synonyms CAP; CAP1-PEN
Locus ID 10487
UniProt ID Q01518
Cytogenetics 1p34.2
Summary The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CAP1 (NM_001105530) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301394 CAP1 MS Standard C13 and N15-labeled recombinant protein (NP_006358) 10 ug
$3,255.00
LC401914 CAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426252 CAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401914 Transient overexpression lysate of CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 1 100 ug
$436.00
LY426252 Transient overexpression lysate of CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 2 100 ug
$436.00
TP301394 Recombinant protein of human CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325806 Purified recombinant protein of Homo sapiens CAP, adenylate cyclase-associated protein 1 (yeast) (CAP1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.