OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFT20 (NM_174887) Human Mass Spec Standard

Be the first to review this product
SKU
PH301337
IFT20 MS Standard C13 and N15-labeled recombinant protein (NP_777547)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY406292 Transient overexpression lysate of intraflagellar transport 20 homolog (Chlamydomonas) (IFT20) (as WB positive control) 100 ug
$436.00

Other products for "IFT20 or NM_174887"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201337
Predicted MW 16 kDa
Protein Sequence
Protein Sequence
>RC201337 protein sequence
Red=Cloning site Green=Tags(s)

MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKM
KSLAVSPRLECTGAISAHCKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSSTAATSSPNSRKE
NAARKVSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_777547
RefSeq Size 1006
RefSeq ORF 444
Locus ID 90410
UniProt ID Q8IY31
Cytogenetics 17q11.2
Summary This gene encodes a intraflagellar transport protein important for intracellular transport. The encoded protein forms part of a complex involved in trafficking of proteins from the Golgi body, including recycling of immune signalling components (Finetti et al., PubMed: 19855387). This gene is part of a complex set of sense-antisense loci that may be co-regulated. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 14.provided by RefSeq, Jun 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFT20" proteins (3)
SKU Description Size Price
LC406292 Lyophilized IFT20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406292 Transient overexpression lysate of intraflagellar transport 20 homolog (Chlamydomonas) (IFT20) (as WB positive control) 100 ug
$436.00
TP301337 Recombinant protein of human intraflagellar transport 20 homolog (Chlamydomonas) (IFT20), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products