COMT (NM_000754) Human Mass Spec Standard
CAT#: PH301275
COMT MS Standard C13 and N15-labeled recombinant protein (NP_000745)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201275 |
Predicted MW | 20 kDa |
Protein Sequence |
>RC201275 protein sequence
Red=Cloning site Green=Tags(s) MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMK DKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDF LAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000745 |
RefSeq Size | 2304 |
RefSeq ORF | 546 |
Synonyms | HEL-S-98n |
Locus ID | 1312 |
UniProt ID | P21964, A0A140VJG8 |
Cytogenetics | 22q11.21 |
Summary | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq, Sep 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400254 | COMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400254 | Transient overexpression lysate of catechol-O-methyltransferase (COMT), transcript variant 1 |
USD 436.00 |
|
PH304127 | COMT MS Standard C13 and N15-labeled recombinant protein (NP_009294) |
USD 3,255.00 |
|
TP301275 | Purified recombinant protein of Homo sapiens catechol-O-methyltransferase (COMT), transcript variant 1, 20 µg |
USD 867.00 |
|
TP304127 | Recombinant protein of human catechol-O-methyltransferase (COMT), transcript variant 4, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review