OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COMT (NM_007310) Human Mass Spec Standard

Be the first to review this product
SKU
PH304127
COMT MS Standard C13 and N15-labeled recombinant protein (NP_009294)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365674 COMT rabbit polyclonal antibody
100 ul
$310.00
LY400254 Transient overexpression lysate of catechol-O-methyltransferase (COMT), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "COMT or NM_007310"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204127
Predicted MW 24.9 kDa
Protein Sequence
Protein Sequence
>RC204127 representing NM_007310
Red=Cloning site Green=Tags(s)

MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFL
DHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKA
IYKGPGSEAGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009294
RefSeq Size 2035
RefSeq ORF 663
Synonyms HEL-S-98n
Locus ID 1312
UniProt ID P21964
Cytogenetics 22q11.21
Summary Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. provided by RefSeq, Sep 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Tyrosine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COMT" proteins (5)
SKU Description Size Price
PH301275 COMT MS Standard C13 and N15-labeled recombinant protein (NP_000745) 10 ug
$3,360.00
LC400254 Lyophilized COMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400254 Transient overexpression lysate of catechol-O-methyltransferase (COMT), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301275 Purified recombinant protein of Homo sapiens catechol-O-methyltransferase (COMT), transcript variant 1, 20 µg 20 ug
$867.00
TP304127 Recombinant protein of human catechol-O-methyltransferase (COMT), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products