OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EIF1 (NM_005801) Human Mass Spec Standard

Be the first to review this product
SKU
PH301271
EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502844 EIF1 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9) 100 ul
$447.00
LY401762 Transient overexpression lysate of eukaryotic translation initiation factor 1 (EIF1) (as WB positive control) 100 ug
$436.00

Other products for "EIF1 or NM_005801"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201271
Predicted MW 12.7 kDa
Protein Sequence
Protein Sequence
>RC201271 protein sequence
Red=Cloning site Green=Tags(s)

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN
GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005792
RefSeq Size 1326
RefSeq ORF 339
Synonyms A121; EIF-1; EIF1A; ISO1; SUI1
Locus ID 10209
UniProt ID P41567
Cytogenetics 17q21.2
Summary Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EIF1" proteins (3)
SKU Description Size Price
LC401762 Lyophilized EIF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401762 Transient overexpression lysate of eukaryotic translation initiation factor 1 (EIF1) (as WB positive control) 100 ug
$436.00
TP301271 Recombinant protein of human eukaryotic translation initiation factor 1 (EIF1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products