EIF1 (NM_005801) Human Recombinant Protein

SKU TP301271

Recombinant protein of human eukaryotic translation initiation factor 1 (EIF1), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201271 protein sequence; Red=Cloning site Green=Tags(s); ; MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN; GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005792
• Locus ID: 10209
• UniProt ID: P41567
• Cytogenetics: 17q21.2
• RefSeq Size: 1326
• RefSeq ORF: 339
• Synonyms: A121; EIF-1; EIF1A; ISO1; SUI1
• Summary: Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.[UniProtKB/Swiss-Prot Function]