EIF1 (NM_005801) Human Recombinant Protein
SKU
TP301271
Recombinant protein of human eukaryotic translation initiation factor 1 (EIF1), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201271 protein sequence
Red=Cloning site Green=Tags(s) MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005792 |
Locus ID | 10209 |
UniProt ID | P41567 |
Cytogenetics | 17q21.2 |
RefSeq Size | 1326 |
RefSeq ORF | 339 |
Synonyms | A121; EIF-1; EIF1A; ISO1; SUI1 |
Summary | Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301271 | EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792) | 10 ug |
$3,255.00
|
|
LC401762 | EIF1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401762 | Transient overexpression lysate of eukaryotic translation initiation factor 1 (EIF1) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.