EIF1 (NM_005801) Human Mass Spec Standard

SKU
PH301271
EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201271]
Predicted MW 12.7 kDa
Protein Sequence
Protein Sequence
>RC201271 protein sequence
Red=Cloning site Green=Tags(s)

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN
GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005792
RefSeq Size 1326
RefSeq ORF 339
Synonyms A121; EIF-1; EIF1A; ISO1; SUI1
Locus ID 10209
UniProt ID P41567
Cytogenetics 17q21.2
Summary Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EIF1 (NM_005801) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401762 EIF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401762 Transient overexpression lysate of eukaryotic translation initiation factor 1 (EIF1) 100 ug
$436.00
TP301271 Recombinant protein of human eukaryotic translation initiation factor 1 (EIF1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.