DLST (NM_001933) Human Mass Spec Standard

CAT#: PH301220

DLST MS Standard C13 and N15-labeled recombinant protein (NP_001924)

Product Images

Coomassie blue staining of purified DLST protein (Cat# TP301220). The protein was produced from HEK293T cells transfected with DLST cDNA clone (Cat# RC201220) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201220
• Predicted MW: 48.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201220 representing NM_001933
  Red=Cloning site Green=Tags(s)
  
  MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDL
  VTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPL
  FTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPL
  AEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGF
  MSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITEL
  GEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL
  TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001924
• RefSeq Size: 2828
• RefSeq ORF: 1359
• Synonyms: DLTS; KGD2; PGL7
• Locus ID: 1743
• UniProt ID: P36957, A0A024R6C9
• Cytogenetics: 14q24.3
• Summary: This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Pathways: Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways