OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASCL1 (NM_004316) Human Mass Spec Standard

Be the first to review this product
SKU
PH301123
ASCL1 MS Standard C13 and N15-labeled recombinant protein (NP_004307)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321640 Anti-ASCL1 Rabbit Polyclonal Antibody
100 ul
$305.00
LY401374 Transient overexpression lysate of achaete-scute complex homolog 1 (Drosophila) (ASCL1) (as WB positive control) 100 ug
$436.00

Other products for "ASCL1 or NM_004316"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201123
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC201123 protein sequence
Red=Cloning site Green=Tags(s)

MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA
DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT
LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS
SYSSDEGSYDPLSPEEQELLDFTNWF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004307
RefSeq Size 2490
RefSeq ORF 708
Synonyms ASH1; bHLHa46; HASH1; MASH1
Locus ID 429
UniProt ID P50553
Cytogenetics 12q23.2
Summary This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ASCL1" proteins (3)
SKU Description Size Price
LC401374 Lyophilized ASCL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401374 Transient overexpression lysate of achaete-scute complex homolog 1 (Drosophila) (ASCL1) (as WB positive control) 100 ug
$436.00
TP301123 Recombinant protein of human achaete-scute complex homolog 1 (Drosophila) (ASCL1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products