OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMC3IP (NM_013290) Human Mass Spec Standard

Be the first to review this product
SKU
PH301045
PSMC3IP MS Standard C13 and N15-labeled recombinant protein (NP_037422)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342445 Rabbit Polyclonal Anti-PSMC3IP Antibody
100 ul
$525.00
LY415686 Transient overexpression lysate of PSMC3 interacting protein (PSMC3IP), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PSMC3IP or NM_013290"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201045
Predicted MW 23.6 kDa
Protein Sequence
Protein Sequence
>RC201045 protein sequence
Red=Cloning site Green=Tags(s)

MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI
YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATN
HVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_037422
RefSeq Size 1440
RefSeq ORF 615
Synonyms GT198; HOP2; HUMGT198A; ODG3; TBPIP
Locus ID 29893
UniProt ID Q9P2W1
Cytogenetics 17q21.2
Summary This gene encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP/MND1 complex, which interacts with PSMC3/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Dec 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMC3IP" proteins (3)
SKU Description Size Price
LC415686 Lyophilized PSMC3IP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415686 Transient overexpression lysate of PSMC3 interacting protein (PSMC3IP), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301045 Recombinant protein of human PSMC3 interacting protein (PSMC3IP), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products