OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRIAP1 (NM_016399) Human Mass Spec Standard

Be the first to review this product
SKU
PH301032
TRIAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057483)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA389744 TRIAP1 Rabbit pAb
100 ul
$410.00
LY413997 Transient overexpression lysate of TP53 regulated inhibitor of apoptosis 1 (TRIAP1) (as WB positive control) 100 ug
$436.00

Other products for "TRIAP1 or NM_016399"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201032
Predicted MW 8.8 kDa
Protein Sequence
Protein Sequence
>RC201032 protein sequence
Red=Cloning site Green=Tags(s)

MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE
KPENSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057483
RefSeq Size 1196
RefSeq ORF 228
Synonyms HSPC132; MDM35; P53CSV; WF-1
Locus ID 51499
UniProt ID O43715
Cytogenetics 12q24.31
Summary Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane (PubMed:23931759). Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo) (PubMed:26071602). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis (PubMed:15735003).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRIAP1" proteins (3)
SKU Description Size Price
LC413997 Lyophilized TRIAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413997 Transient overexpression lysate of TP53 regulated inhibitor of apoptosis 1 (TRIAP1) (as WB positive control) 100 ug
$436.00
TP301032 Recombinant protein of human TP53 regulated inhibitor of apoptosis 1 (TRIAP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products